Glucagon Like Peptide 1 (GLP-1, amide, human) - FAM labeled

Catalog #:

Shipping advice for credit card purchase:

Suitable for Two-Day Shipping (2-3 Days). For international shipping rate please contact us for details

Synonyms: FAM-HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2

Functional Activity:

This is a fluorescent (FAM)-labeled Glucagon-like peptide, Abs/Em=494/521 nm.

Technical Data:

M.Wt: 4469.8

Sequence (one-letter code): FAM-HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2

Sequence (three-letter code): FAM - His - Asp - Glu - Phe - Glu - Arg - His - Ala - Glu - Gly - Thr - Phe - Thr - Ser - Asp - Val - Ser - Ser - Tyr - Leu - Glu - Gly - Gln - Ala - Ala - Lys - Glu - Phe - Ile - Ala - Trp - Leu - Val - Lys - Gly - Arg - NH2

Excitation (nm): 494

Emission (nm): 521

Solubility: Soluble in DMSO

Purity: >95% (HPLC)

Shipping Conditions: Room temperature

Storage: Store and desiccate at -20°C and protect from light.

Related Products by Target:

References for Glucagon Like Peptide 1 (GLP-1, amide, human) - FAM labeled :

Certificate of Analysis/MSDS is available upon request

For bulk or custom order please contact us for details