Glucagon (1 - 29)(bovine, human, porcine) - FAM labeled

Catalog #:

Shipping advice for credit card purchase:

Suitable for Two-Day Shipping (2-3 Days). For international shipping rate please contact us for details

Synonyms: FAM-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT

Functional Activity:

This is a fluorescent (FAM)-labeled Glucagon peptide, Abs/Em=494/521 nm.

Technical Data:

M.Wt: 3841.1

Sequence (one-letter code): FAM-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT

Sequence (three-letter code): FAM - His - Ser - Gln - Gly - Thr - Phe - Thr - Ser - Asp - Tyr - Ser - Lys - Tyr - Leu - Asp - Ser - Arg - Arg - Ala - Gln - Asp - Phe - Val - Gln - Trp - Leu - Met - Asn - Thr - OH

Excitation (nm): 494

Emission (nm): 521

Solubility: Soluble in DMSO

Purity: >95% (HPLC)

Shipping Conditions: Room temperature

Storage: Store and desiccate at -20°C and protect from light.

Related Products by Target:

References for Glucagon (1 - 29)(bovine, human, porcine) - FAM labeled :

Certificate of Analysis/MSDS is available upon request

For bulk or custom order please contact us for details