Galanin Lys (Biotin)(human) - FAM labeled
Catalog #:
ABBFO2031Shipping advice for credit card purchase:
Suitable for Two-Day Shipping (2-3 Days). For international shipping rate please contact us for details
ABBFO2031-1mg | USD299.0 |
Synonyms: FAM-GWTLNSAGYLLGPHAVGNHRSFSDKNGLTSK(Biotin)

Functional Activity:
This is a N-terminus fluorescent (FAM)-labeled and C-terminus biotinylated Galanin peptide, Abs/Em=494/521nm.
Technical Data:
M.Wt: 3870.2
Sequence (one-letter code): FAM-GWTLNSAGYLLGPHAVGNHRSFSDKNGLTSK(Biotin)
Sequence (three-letter code): FAM - Gly - Trp - Thr - Leu - Asn - Ser - Ala - Gly - Tyr - Leu - Leu - Gly - Pro - His - Ala - Val - Gly - Asn - His - Arg - Ser - Phe - Ser - Asp - Lys - Asn - Gly - Leu - Thr - Ser - Lys(Biotin) - OH
Excitation (nm): 494
Emission (nm): 521
Solubility: Soluble in DMSO
Purity: >95% (HPLC)
Shipping Conditions: Room temperature
Storage: Store and desiccate at -20°C and protect from light.
Related Products by Target:
References for Galanin Lys (Biotin)(human) - FAM labeled :
Certificate of Analysis/MSDS is available upon request
For bulk or custom order please contact us for details